PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01008980001
Common NameVIT_18s0001g04810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 98aa    MW: 11538.4 Da    PI: 9.901
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01008980001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.69.3e-251058250
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       rie+k  rqv+fs+R++g++KKA+ELSvLCd+++a+i+f ++g+l  +s
  GSVIVT01008980001 10 RIEDKATRQVSFSRRKKGLIKKAYELSVLCDIDIALIMFPPSGRLTQFS 58
                       8*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.5E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.46161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-29286IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-22323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-223859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009010anatomyseed
PO:0025501developmental stagefruit formation stage
PO:0025502developmental stagefruit ripening stage
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MGRGKQEMRR IEDKATRQVS FSRRKKGLIK KAYELSVLCD IDIALIMFPP SGRLTQFSGK  60
KRMEEVFTRY MHLTDEEREE YALELLVQFA FERVWSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-18186185Myocyte-specific enhancer factor 2B
1tqe_Q2e-18186185Myocyte-specific enhancer factor 2B
1tqe_R2e-18186185Myocyte-specific enhancer factor 2B
1tqe_S2e-18186185Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4860847e-97AM486084.2 Vitis vinifera contig VV78X084760.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010664907.14e-51PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ1PFC28e-32AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLE0CRG33e-66E0CRG3_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g04810.t018e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.22e-33AGAMOUS-like 67